PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027109.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 818aa    MW: 89687.4 Da    PI: 6.8413
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027109.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-082783151954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  L++++gLt +q+++WF N R +
  Do027109.1 278 FEHflHPYPKDSEKIMLSRQTGLTRSQISNWFINARVR 315
                 664559******************************88 PP

2BELL96.22.9e-311552121572
        BELL  15 lleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +  +Vd++Yk+y++q+q vissF++vag g+akpYt++Al++iSrhFrcLkdai +qi
  Do027109.1 155 ICFQVDRKYKHYYHQMQLVISSFDMVAGSGAAKPYTAVALQTISRHFRCLKDAINDQI 212
                 5669****************************************************98 PP

3BELL53.46.2e-18646708971
        BELL   9 kakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                 +akLl ll e++ r ++y  +l  v+ssFe + g g+a  Ytsl  +a++rhF +L+ ai  +
  Do027109.1 646 QAKLLGLLSELESRQERYFGELGRVASSFEPALGDGAASAYTSLMAQAMARHFGNLRRAILRR 708
                 58**********************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.4E-1264210IPR006563POX domain
PfamPF075262.4E-25158208IPR006563POX domain
PROSITE profilePS5007112.001256319IPR001356Homeobox domain
SMARTSM003892.0E-9259323IPR001356Homeobox domain
CDDcd000861.88E-12259320No hitNo description
SuperFamilySSF466897.7E-17260325IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-28262325IPR009057Homeodomain-like
PfamPF059201.6E-17276315IPR008422Homeobox KN domain
SMARTSM005741.4E-11580707IPR006563POX domain
PfamPF075263.9E-23585705IPR006563POX domain
Gene3DG3DSA:1.10.10.601.4E-11763811IPR009057Homeodomain-like
CDDcd000860.0045764812No hitNo description
SuperFamilySSF466891.41E-6770811IPR009057Homeodomain-like
PfamPF059203.3E-7781811IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MPSALGNLLY PNNASSGLYT EFSGIIQPQQ NFMELPVHPS AMSHDSSSNE ATNMGTSLTE  60
QRSFGPLKDM RNEMLMHLMD GGHSSGSDLI HNDAHNTAQV EFGMLNNHNS TSVPSAPGQG  120
LSLSLNTHIL APSYPYWSAK PELLTPNSYQ DHIDICFQVD RKYKHYYHQM QLVISSFDMV  180
AGSGAAKPYT AVALQTISRH FRCLKDAIND QIGVIRKKLG EDDNTSGKEG KLTRLRYIDQ  240
QIRQQRAFQQ YGMLQQNAWR PQRGLPENSV SILRAWLFEH FLHPYPKDSE KIMLSRQTGL  300
TRSQISNWFI NARVRLWKPM IEDMYKEEVG DAELDSNSSS DNGARSKDKA PSSEEKEDLK  360
TSTSQACQSS QLEESKANVG GMMSLSGVPA GGFHNEANPE DSFMSLMMKA QRPGECDGSG  420
LLHHAVAHHS DESSQFMAYH LAELGRYGNN NVSLTLGLQH AENSLASVPN TQPGFPGVRD  480
EDIYNSTAPL NLPMVMAKQH EKGSPKRAPN EPGPHLAVPG RPSQPAPFRL EQCCHCDDHR  540
RQDDGSSNGA GPLLLTLGPL GSATNRRCSC GVAPAPAPAA ATMSVLRGSR YLRPAQELLG  600
EVVRMADLTA GAGDEEAAAE KAERLEGAGG RRAVRRAAKN DGDGVQAKLL GLLSELESRQ  660
ERYFGELGRV ASSFEPALGD GAASAYTSLM AQAMARHFGN LRRAILRRLR LHAAVAATRS  720
LRAGEEGERR NGDDDEDEEV TEEMVDRVAR RTKLAAAARA EQAWRPLRGL PEGSVAVLRA  780
WLFDHFLHPY PDDGEKLRLA VTTGLSRSQV RTAAPQIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16265322158Homeobox protein Meis1
4xrs_B2e-16265322158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9571390.0EU957139.1 Zea mays clone 1583941 BEL1-related homeotic protein 30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982177.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004982178.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0E0D4K80.0A0A0E0D4K8_9ORYZ; Uncharacterized protein
STRINGSi034602m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.24e-87BEL1-like homeodomain 6